PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pp3c1_30500V3.2.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Bryophyta; Bryophytina; Bryopsida; Funariidae; Funariales; Funariaceae; Physcomitrella
Family MIKC_MADS
Protein Properties Length: 357aa    MW: 39766 Da    PI: 8.7155
Description MIKC_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pp3c1_30500V3.2.pgenomeCOSMOSSView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF871.1e-2761111151
                        S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS
             SRF-TF   1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51 
                        k+ien + rqvtfskRr g+lKKA+EL vLCdaeva+iifsstgkl+e++s
  Pp3c1_30500V3.2.p  61 KKIENPTSRQVTFSKRRGGLLKKAHELAVLCDAEVALIIFSSTGKLFEFAS 111
                        68***********************************************86 PP

2bZIP_119.91.6e-062232671757
                        HHHHHHHHHH....HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
             bZIP_1  17 ArrsRqRKka....eieeLeekvkeLeaeNkaLkkeleelkkeva 57 
                        A+r R+RK +    eie+L++k   L+aeN++L+k+l + k++++
  Pp3c1_30500V3.2.p 223 ASRVRARKNQllleEIEQLRQKELDLQAENEDLRKKLAHVKETAE 267
                        99******74333399*************************9876 PP

3K-box65.91.5e-221972603699
              K-box  36 RhllGedLesLslkeLqqLeqqLekslkkiRskKnellleqieelqkkekelqeenkaLrkkle 99 
                        R++lGedL+ L++ +L qLeqqL+ + +++R++Kn+llle+ie+l++ke +lq en++Lrkkl+
  Pp3c1_30500V3.2.p 197 RQMLGEDLQVLTVSDLLQLEQQLDVGASRVRARKNQLLLEEIEQLRQKELDLQAENEDLRKKLA 260
                        9*************************************************************86 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5006633.01153113IPR002100Transcription factor, MADS-box
SMARTSM004321.6E-4253112IPR002100Transcription factor, MADS-box
SuperFamilySSF554558.63E-3454141IPR002100Transcription factor, MADS-box
CDDcd002658.93E-4554128No hitNo description
PROSITE patternPS00350055109IPR002100Transcription factor, MADS-box
PRINTSPR004043.8E-305575IPR002100Transcription factor, MADS-box
PfamPF003198.9E-2662109IPR002100Transcription factor, MADS-box
PRINTSPR004043.8E-307590IPR002100Transcription factor, MADS-box
PRINTSPR004043.8E-3090111IPR002100Transcription factor, MADS-box
PROSITE profilePS5129712.762135265IPR002487Transcription factor, K-box
PfamPF014862.9E-19197259IPR002487Transcription factor, K-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 357 aa     Download sequence    Send to blast
MMTASGQYRS LQRFCSQRNS DSWRTTHGGA GRVVLDSSSF VGKVDPPKER EVMGRGKIEI  60
KKIENPTSRQ VTFSKRRGGL LKKAHELAVL CDAEVALIIF SSTGKLFEFA SSGSMRDILE  120
RYSKCPDGVQ TTGNVDFMGR EVVKLRQQLE RMQHSQRKST RFHIMSIFLS ACLLVYGLTN  180
LSAASVHGLD DVVLVCRQML GEDLQVLTVS DLLQLEQQLD VGASRVRARK NQLLLEEIEQ  240
LRQKELDLQA ENEDLRKKLA HVKETAEVSG HTGTSESPSQ VASASAYETG GISAQVTMVY  300
PTHPNLRDPQ TSQTSLHLGL FPESFVPNTS RRPSQRSPTD PEGESSIRWE RYRGQE*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3mu6_D6e-1954123169Myocyte-specific enhancer factor 2A
3mu6_C6e-1954123169Myocyte-specific enhancer factor 2A
3mu6_B6e-1954123169Myocyte-specific enhancer factor 2A
3mu6_A6e-1954123169Myocyte-specific enhancer factor 2A
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankDQ1913231e-138DQ191323.1 Physcomitrella patens classical MIKC-type MADS-box gene, partial cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_001774085.11e-179MIKCC MADS-domain protein PpMADS-S
TrEMBLA9T6251e-179A9T625_PHYPA; MIKCC MADS-domain protein PpMADS-S
STRINGPP1S209_130V6.11e-136(Physcomitrella patens)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP1617761
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G09960.19e-41MIKC_MADS family protein